RetrogeneDB ID: | retro_ttru_317 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | GeneScaffold_1840:186658..186894(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C19orf53 | ||
| Ensembl ID: | ENSTTRG00000010354 | ||
| Aliases: | None | ||
| Description: | chromosome 19 open reading frame 53 [Source:HGNC Symbol;Acc:24991] |
| Percent Identity: | 66.27 % |
| Parental protein coverage: | 83.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KTAATASERNR-GPRKGGLVIAPKKARIVQQQKLKKNLEVGIRKKIEHDVLMKASSSLPKKLALLKAPTK |
| KT.A.A.E.NR.GPRKG...I.PKKA..VQQQKL..NL.V.I.K.I.HDV.MKAS.SLP..LALLK..T. | |
| Retrocopy | KTVA-ALEWNR<GPRKGHWFITPKKASMVQQQKLE*NLAVRIWKNIKHDV-MKASTSLPENLALLKTLT- |
| Parental | KKAAAPASTKTPS |
| KK.AA..STKTPS | |
| Retrocopy | KKVAAFSSTKTPS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002525 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004427 | 3 retrocopies | |
| Homo sapiens | ENSG00000104979 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027024 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011876 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013141 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007185 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000014250 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000010565 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000006321 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010354 | 1 retrocopy |
retro_ttru_317 ,
|