RetrogeneDB ID: | retro_cjac_1017 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 12:23480141..23480329(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ACBD7 | ||
| Ensembl ID: | ENSCJAG00000009249 | ||
| Aliases: | None | ||
| Description: | acyl-CoA binding domain containing 7 [Source:HGNC Symbol;Acc:17715] |
| Percent Identity: | 65.62 % |
| Parental protein coverage: | 71.59 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | DGELRDLYGLYKQATIGDINIECPGMLDLKGKAKWEAWNLQKG-LSTEDAMTAYISKAKELIEK |
| D..L...YGLYKQA..G.IN.E..GML.LKGKA.WEAWNLQ.G.LS.EDA..A.I.KA.E.IEK | |
| Retrocopy | DEKLKECYGLYKQAITGNINSEYLGMLGLKGKAEWEAWNLQEG<LSVEDAVSASICKANEPIEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 0 .02 RPM |
| SRP051959_heart | 0 .00 RPM | 0 .00 RPM |
| SRP051959_kidney | 0 .00 RPM | 0 .04 RPM |
| SRP051959_liver | 0 .02 RPM | 0 .00 RPM |
| SRP051959_lung | 0 .00 RPM | 0 .08 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 0 .02 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .02 RPM |
| SRP051959_spleen | 0 .02 RPM | 0 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1669 |
| Pan troglodytes | retro_ptro_1132 |
| Gorilla gorilla | retro_ggor_1257 |
| Pongo abelii | retro_pabe_1376 |
| Macaca mulatta | retro_mmul_1577 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000009249 | 1 retrocopy |
retro_cjac_1017 ,
|
| Callithrix jacchus | ENSCJAG00000021436 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027337 | 1 retrocopy | |
| Homo sapiens | ENSG00000176244 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015777 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000010587 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000012353 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002111 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000041316 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000007153 | 1 retrocopy |