RetrogeneDB ID: | retro_cjac_954 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 12:4179077..4179291(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DBI | ||
Ensembl ID: | ENSCJAG00000021436 | ||
Aliases: | None | ||
Description: | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690] |
Percent Identity: | 63.51 % |
Parental protein coverage: | 81.4 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | LKTKPGDDEMLFIYGHYKQATVGDINTERPGMLDFKGKA-KWDAWNELKGTTKEDAMK--AYI-NKVEEL |
.KTKP.DDE.LF.Y..Y...TVGDI.TE.P.MLDFKGKA...D.WN.LKG..KEDAMK..AYI..K.EE. | |
Retrocopy | VKTKPADDEVLFLYCRYRHTTVGDISTEQPRMLDFKGKA<QRDPWN*LKGAAKEDAMKARAYI<HKAEER |
Parental | KKKY |
KK.. | |
Retrocopy | KKQF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 40 .67 RPM |
SRP051959_heart | 0 .00 RPM | 47 .06 RPM |
SRP051959_kidney | 0 .00 RPM | 45 .64 RPM |
SRP051959_liver | 0 .00 RPM | 64 .18 RPM |
SRP051959_lung | 0 .00 RPM | 18 .59 RPM |
SRP051959_lymph_node | 0 .00 RPM | 21 .05 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 23 .54 RPM |
SRP051959_spleen | 0 .00 RPM | 30 .48 RPM |