RetrogeneDB ID: | retro_ptro_1018 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 15:54167975..54168239(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ACBD7 | ||
Ensembl ID: | ENSPTRG00000041316 | ||
Aliases: | None | ||
Description: | acyl-CoA binding domain containing 7 [Source:HGNC Symbol;Acc:17715] |
Percent Identity: | 76.14 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MALQADFDRAAEDVRKLKARPDAGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED |
M.LQADFD...EDVRKLK.RPD..ELKELYGLYKQA..G.INI.C..ML.LKGKAKWEA.N..KGLS.ED | |
Retrocopy | MSLQADFDMVTEDVRKLKTRPDDEELKELYGLYKQAVIGNINIECSEMLELKGKAKWEAQNPQKGLSEED |
Parental | AMSAYISKAKELIEKYGI |
.MSA.ISKA.ELIEKYGI | |
Retrocopy | MMSAFISKAEELIEKYGI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 3 .63 RPM |
SRP007412_cerebellum | 0 .00 RPM | 3 .80 RPM |
SRP007412_heart | 0 .00 RPM | 0 .03 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .16 RPM |
SRP007412_liver | 0 .00 RPM | 0 .07 RPM |
SRP007412_testis | 0 .00 RPM | 1 .26 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1501 |
Gorilla gorilla | retro_ggor_1152 |
Pongo abelii | retro_pabe_1252 |
Macaca mulatta | retro_mmul_2141 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000009249 | 1 retrocopy | |
Felis catus | ENSFCAG00000027337 | 1 retrocopy | |
Homo sapiens | ENSG00000176244 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000015777 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000010587 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000012353 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000002111 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000012401 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000041316 | 3 retrocopies |
retro_ptro_1018 , retro_ptro_1132, retro_ptro_530,
|
Pteropus vampyrus | ENSPVAG00000007153 | 1 retrocopy |