RetrogeneDB ID: | retro_cjac_1099 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 13:54505474..54505786(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NAA20 | ||
Ensembl ID: | ENSCJAG00000005377 | ||
Aliases: | None | ||
Description: | N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:HGNC Symbol;Acc:15908] |
Percent Identity: | 91.35 % |
Parental protein coverage: | 58.43 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | TLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHG |
T...FTC.DLFRFNN.NLDPLTETYGIPFYLQYL.HWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHG | |
Retrocopy | TYFSFTCADLFRFNNSNLDPLTETYGIPFYLQYLTHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHG |
Parental | HVTALSVAPEFRRLGLAAKLMELLEEISERKGGF |
.VTALS.APEF.RLGLAAKLMELLEEISERKGGF | |
Retrocopy | YVTALSAAPEF*RLGLAAKLMELLEEISERKGGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 15 .11 RPM |
SRP051959_heart | 0 .00 RPM | 25 .70 RPM |
SRP051959_kidney | 0 .00 RPM | 25 .96 RPM |
SRP051959_liver | 0 .00 RPM | 24 .84 RPM |
SRP051959_lung | 0 .00 RPM | 20 .50 RPM |
SRP051959_lymph_node | 0 .02 RPM | 19 .31 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 38 .52 RPM |
SRP051959_spleen | 0 .00 RPM | 18 .95 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000001144 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000032025 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005377 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000004247 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000006044 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007708 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000001228 | 2 retrocopies | |
Mus musculus | ENSMUSG00000002728 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000009855 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000015481 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000011542 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000010746 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000013299 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000014733 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000000969 | 1 retrocopy |