RetrogeneDB ID: | retro_btau_899 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 20:10308663..10309026(+) | ||
| Located in intron of: | ENSBTAG00000046192 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NAA20 | ||
| Ensembl ID: | ENSBTAG00000001144 | ||
| Aliases: | NAA20, NAT5 | ||
| Description: | N-alpha-acetyltransferase 20 [Source:RefSeq peptide;Acc:NP_001193758] |
| Percent Identity: | 75.81 % |
| Parental protein coverage: | 64.36 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MGKAEGSVAREEWHGHVTALS-VAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQL |
| MGKAEGSVAREEWHGHV.ALS.VA.EF...GLAAKLMELLEE.SER.GGF.VDLFVRVSN.VAVNMYK.L | |
| Retrocopy | MGKAEGSVAREEWHGHVIALS<VALEFWCHGLAAKLMELLEEVSERTGGFLVDLFVRVSNPVAVNMYKRL |
| Parental | GYSVYRTV-IEYYSASNGEPDEDA-YDMRKALSRDTEKKSIIPLPHPVRPEDIE |
| GYS....V....YSA.NGE.DED..Y.MRKA.S.D.E.KSIIPLP.PVRPED.E | |
| Retrocopy | GYSMDTIVRSTIYSARNGELDEDS>YNMRKARSKDSE-KSIIPLPLPVRPEDTE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .43 RPM | 34 .61 RPM |
| ERP005899_muscle | 0 .26 RPM | 30 .25 RPM |
| SRP017611_brain | 1 .37 RPM | 28 .60 RPM |
| SRP017611_kidney | 0 .65 RPM | 54 .23 RPM |
| SRP017611_liver | 0 .53 RPM | 11 .10 RPM |
| SRP030211_testis | 0 .86 RPM | 34 .64 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000001144 | 1 retrocopy |
retro_btau_899 ,
|
| Canis familiaris | ENSCAFG00000032025 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005377 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004247 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000006044 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007708 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000001228 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000002728 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009855 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015481 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011542 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010746 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013299 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014733 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000969 | 1 retrocopy |