RetrogeneDB ID: | retro_cjac_439 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 1:82805420..82805790(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000014812 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NAA20 | ||
| Ensembl ID: | ENSCJAG00000005377 | ||
| Aliases: | None | ||
| Description: | N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:HGNC Symbol;Acc:15908] |
| Percent Identity: | 92.74 % |
| Parental protein coverage: | 74.1 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | YIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFF-VDLFVRVSNQVAVNMYK |
| Y..GKAEGSVAREEWHGHV.ALSVAPEFRRLGLA.KL.ELLEEISERKGGFF.VDLFVRVSNQVAVNMYK | |
| Retrocopy | YFIGKAEGSVAREEWHGHVPALSVAPEFRRLGLAPKLRELLEEISERKGGFF>VDLFVRVSNQVAVNMYK |
| Parental | QLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDIEKKSIIPLPHPVRPEDIE |
| QLGYSVY.TVIEYYSASNGEPDEDAYDMRKALSRD.EK.SIIPLPHPVRPEDIE | |
| Retrocopy | QLGYSVYSTVIEYYSASNGEPDEDAYDMRKALSRDTEKESIIPLPHPVRPEDIE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 15 .11 RPM |
| SRP051959_heart | 0 .02 RPM | 25 .70 RPM |
| SRP051959_kidney | 0 .04 RPM | 25 .96 RPM |
| SRP051959_liver | 0 .02 RPM | 24 .84 RPM |
| SRP051959_lung | 0 .00 RPM | 20 .50 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 19 .31 RPM |
| SRP051959_skeletal_muscle | 0 .04 RPM | 38 .52 RPM |
| SRP051959_spleen | 0 .02 RPM | 18 .95 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000001144 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000032025 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005377 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004247 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000006044 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007708 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000001228 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000002728 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009855 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015481 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011542 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010746 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013299 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014733 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000969 | 1 retrocopy |