RetrogeneDB ID: | retro_cjac_2314 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 4:22291298..22291529(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNAPC5 | ||
Ensembl ID: | ENSCJAG00000007484 | ||
Aliases: | None | ||
Description: | small nuclear RNA activating complex, polypeptide 5, 19kDa [Source:HGNC Symbol;Acc:15484] |
Percent Identity: | 71.43 % |
Parental protein coverage: | 78.57 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | QELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSQTVPEQSHDMLVHVDNEASINQTT |
QELRKEE..LL.L.AAL.DQLNR.KVE.LALQSM..SRRGDEMLSS.T.PEQ...M.VHVDN.AS.N..T | |
Retrocopy | QELRKEEAMLLLLNAALCDQLNRVKVEALALQSMSDSRRGDEMLSSPTAPEQPYVMYVHVDNKASVNPPT |
Parental | LELSTKS |
LE.S..S | |
Retrocopy | LE*SIES |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 2 .40 RPM |
SRP051959_heart | 0 .00 RPM | 4 .05 RPM |
SRP051959_kidney | 0 .00 RPM | 4 .33 RPM |
SRP051959_liver | 0 .00 RPM | 1 .84 RPM |
SRP051959_lung | 0 .00 RPM | 2 .88 RPM |
SRP051959_lymph_node | 0 .00 RPM | 3 .20 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 3 .80 RPM |
SRP051959_spleen | 0 .00 RPM | 3 .55 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000017304 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000007484 | 1 retrocopy |
retro_cjac_2314 ,
|
Dasypus novemcinctus | ENSDNOG00000006689 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000003693 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000003990 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016841 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032398 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000012935 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000008791 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000010156 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000009201 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014333 | 1 retrocopy |