RetrogeneDB ID: | retro_mmul_1815 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 4:6230899..6231146(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.1494 | ||
| Ensembl ID: | ENSMMUG00000016841 | ||
| Aliases: | None | ||
| Description: | snRNA-activating protein complex subunit 5 [Source:RefSeq peptide;Acc:NP_001248181] |
| Percent Identity: | 71.08 % |
| Parental protein coverage: | 80.61 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | QELRKEEETLLRLKAAL-HDQLNRLKVEELALQSMISSRRGDEMLSSHTVP---EQSHDMLVHVDNEASI |
| QEL.KEEETLL.LKA.L.H...N..KVE.LALQS.ISSRRGDE.LSS.T.P...EQS..M.VH.DNEAS. | |
| Retrocopy | QELHKEEETLLPLKATL>HNLVNHIKVETLALQSTISSRRGDEVLSSPTSPTAPEQSLVMSVHIDNEASV |
| Parental | NQTTLELSTKSHV |
| NQTTLE.STKS.V | |
| Retrocopy | NQTTLEWSTKSPV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 15 .91 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .24 RPM | 13 .33 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 16 .79 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .83 RPM |
| SRP007412_kidney | 0 .00 RPM | 12 .32 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .85 RPM |
| SRP007412_testis | 0 .00 RPM | 9 .16 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_2398 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000017304 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007484 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000006689 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003693 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003990 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016841 | 1 retrocopy |
retro_mmul_1815 ,
|
| Mus musculus | ENSMUSG00000032398 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012935 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000008791 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000010156 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000009201 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014333 | 1 retrocopy |