RetrogeneDB ID: | retro_cjac_2627 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 5:82042432..82042833(-) | ||
Located in intron of: | ENSCJAG00000019781 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DENR | ||
Ensembl ID: | ENSCJAG00000020488 | ||
Aliases: | None | ||
Description: | density-regulated protein [Source:HGNC Symbol;Acc:2769] |
Percent Identity: | 64.79 % |
Parental protein coverage: | 69.31 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | EKNFPNEFAKLTVARKYTPKQETGISEGQGTAGGSQRKKKLNKGGRGQIKQKKKTVPQKVTIAKIPRAKK |
EK.FPNE..KLTV.....P.QE.GIS..QG.A.....KK..N..G....KQKK.TVP..V.I.KI.R.KK | |
Retrocopy | EKDFPNESEKLTVEN--SPNQEAGISKSQGRARQREKKKQENWKGSNKTKQKK-TVP*EVIITKIAREKK |
Parental | KYVTRVCGLATFEIEIDLKEAQR-FFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQ-EKWPEVDDDSIE |
KYV..VCGLATFEI..DLKEAQR.FFAQ.F.CG.SVTGEDE.IIQ.D.T.DIIDVIQ..K.PE.DDDSI. | |
Retrocopy | KYVKIVCGLATFEI--DLKEAQR>FFAQ*F-CGTSVTGEDE-IIQEDSTNDIIDVIQ>KKEPEIDDDSIK |
Parental | DL |
DL | |
Retrocopy | DL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .02 RPM | 4 .28 RPM |
SRP051959_heart | 0 .12 RPM | 3 .51 RPM |
SRP051959_kidney | 0 .40 RPM | 4 .93 RPM |
SRP051959_liver | 0 .00 RPM | 5 .94 RPM |
SRP051959_lung | 0 .42 RPM | 3 .24 RPM |
SRP051959_lymph_node | 0 .32 RPM | 5 .23 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 3 .78 RPM |
SRP051959_spleen | 0 .17 RPM | 5 .19 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1854 |
Pan troglodytes | retro_ptro_1236 |
Gorilla gorilla | retro_ggor_2156 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000016012 | 1 retrocopy | |
Bos taurus | ENSBTAG00000032433 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000020488 | 4 retrocopies | |
Echinops telfairi | ENSETEG00000013029 | 1 retrocopy | |
Homo sapiens | ENSG00000139726 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000005562 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000002088 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002186 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008150 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000015974 | 5 retrocopies | |
Pongo abelii | ENSPPYG00000005073 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000005584 | 4 retrocopies | |
Sorex araneus | ENSSARG00000004446 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000009788 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000015856 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000011472 | 1 retrocopy |