RetrogeneDB ID: | retro_ocun_1325 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 7:122997965..122998292(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DENR | ||
| Ensembl ID: | ENSOCUG00000008150 | ||
| Aliases: | None | ||
| Description: | density-regulated protein [Source:HGNC Symbol;Acc:2769] |
| Percent Identity: | 74.77 % |
| Parental protein coverage: | 55.05 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MASDVSECSGADCKGDPRNSAKLDAGY-PLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLT |
| MASD.SE.SGADC.GD.R.SAK.DA.Y.PL.VLYCG.CS.PTEYCEYMP..AK.RQ.LEKNFPNEFAKLT | |
| Retrocopy | MASDISESSGADCRGDTRHSAKVDADY<PLQVLYCGACSFPTEYCEYMPAIAKHRQGLEKNFPNEFAKLT |
| Parental | VENS-PKQEAGITEGQGTAGEEEEKKKQKRGGRGQIKQKKK |
| .ENS.PK..AGI..GQGT.GEE.EKK.Q.RGGR.Q.K.KKK | |
| Retrocopy | IENS>PKKKAGIMGGQGTIGEEKEKKNQRRGGRHQKKKKKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 57 .89 RPM |
| SRP017611_kidney | 0 .00 RPM | 41 .05 RPM |
| SRP017611_liver | 0 .00 RPM | 20 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000016012 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000032433 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000020488 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000013029 | 1 retrocopy | |
| Homo sapiens | ENSG00000139726 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005562 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002088 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002186 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008150 | 2 retrocopies |
retro_ocun_1325 , retro_ocun_1524,
|
| Ochotona princeps | ENSOPRG00000015974 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000005073 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000005584 | 4 retrocopies | |
| Sorex araneus | ENSSARG00000004446 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000009788 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015856 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000011472 | 1 retrocopy |