RetrogeneDB ID: | retro_cjac_2745 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 6:95786321..95786524(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCJAG00000032423 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPLP2 | ||
Ensembl ID: | ENSCJAG00000011838 | ||
Aliases: | None | ||
Description: | ribosomal protein, large, P2 [Source:HGNC Symbol;Acc:10377] |
Percent Identity: | 79.71 % |
Parental protein coverage: | 59.13 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MRYVASYLLAALGG-NPSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAG |
M.Y.ASYLLAALGG.NPSPSA.DIKKILDS.G.EA..D.LNKVISELNGKNIED.I.Q..GKLAS.PAG | |
Retrocopy | MYYIASYLLAALGG<NPSPSAEDIKKILDSMGREANNDQLNKVISELNGKNIEDMITQRVGKLASIPAG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 56 .29 RPM |
SRP051959_heart | 0 .02 RPM | 48 .41 RPM |
SRP051959_kidney | 0 .00 RPM | 50 .56 RPM |
SRP051959_liver | 0 .00 RPM | 57 .68 RPM |
SRP051959_lung | 0 .00 RPM | 68 .44 RPM |
SRP051959_lymph_node | 0 .00 RPM | 125 .31 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 72 .76 RPM |
SRP051959_spleen | 0 .00 RPM | 70 .78 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006935 | 1 retrocopy | |
Bos taurus | ENSBTAG00000001777 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000009523 | 1 retrocopy | |
Ciona intestinalis | ENSCING00000000626 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000011838 | 6 retrocopies |
retro_cjac_2399, retro_cjac_2497, retro_cjac_2539, retro_cjac_2745 , retro_cjac_3097, retro_cjac_3859,
|
Echinops telfairi | ENSETEG00000010240 | 4 retrocopies | |
Felis catus | ENSFCAG00000008417 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020627 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000009049 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000026860 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000016296 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000002116 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000001056 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012842 | 1 retrocopy |