RetrogeneDB ID: | retro_btau_1399 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 5:98729817..98730042(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPLP2 | ||
| Ensembl ID: | ENSBTAG00000001777 | ||
| Aliases: | None | ||
| Description: | 60S acidic ribosomal protein P2 [Source:UniProtKB/Swiss-Prot;Acc:P42899] |
| Percent Identity: | 78.67 % |
| Parental protein coverage: | 65.22 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELHGKNIEDVIAQGIGKLASVPAGGA |
| .RYVASYLLAA..GNSSPS.KD..KILDS..I..DDDRLNKVISEL..KN.EDVI..GIGKLASVPAGGA | |
| Retrocopy | LRYVASYLLAARWGNSSPSSKDMGKILDSMCIQTDDDRLNKVISELNRKNTEDVIV*GIGKLASVPAGGA |
| Parental | VAVSA |
| .AVSA | |
| Retrocopy | LAVSA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 37 .20 RPM |
| ERP005899_muscle | 0 .00 RPM | 574 .71 RPM |
| SRP017611_brain | 0 .00 RPM | 60 .98 RPM |
| SRP017611_kidney | 0 .00 RPM | 140 .83 RPM |
| SRP017611_liver | 0 .00 RPM | 158 .72 RPM |
| SRP030211_testis | 0 .00 RPM | 128 .39 RPM |