RetrogeneDB ID: | retro_cjac_2853 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 6:133025174..133025557(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PTS | ||
Ensembl ID: | ENSCJAG00000012437 | ||
Aliases: | None | ||
Description: | 6-pyruvoyltetrahydropterin synthase [Source:HGNC Symbol;Acc:9689] |
Percent Identity: | 77.52 % |
Parental protein coverage: | 88.28 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | ISFSASHRLHSKFLSEEENLKLFGKCSNPNGHGHNYKVVVTVHGQIDPATGMVMNLTDLKKHMEEAIMQP |
ISFSAS.RLHS.FLS..ENLKL..KC.NPNG.GHNYK.VVT.....DPATGMVMNL..LKK.MEEA.MQP | |
Retrocopy | ISFSASRRLHSEFLSDKENLKLLRKCINPNGCGHNYKAVVTTRREVDPATGMVMNLAALKKYMEEAVMQP |
Parental | LDHKNLDLDVPYFA-DVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE |
.DHKNL..DVPYFA.D.VSTTENVAVYIWD.LQKVLPVGVL.K.KV.ETDNN..VYKGE | |
Retrocopy | FDHKNLNMDVPYFA<DAVSTTENVAVYIWDTLQKVLPVGVLHKAKVCETDNNVAVYKGE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 1 .46 RPM |
SRP051959_heart | 0 .02 RPM | 2 .86 RPM |
SRP051959_kidney | 0 .00 RPM | 8 .54 RPM |
SRP051959_liver | 0 .00 RPM | 11 .42 RPM |
SRP051959_lung | 0 .00 RPM | 2 .28 RPM |
SRP051959_lymph_node | 0 .00 RPM | 1 .55 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 1 .75 RPM |
SRP051959_spleen | 0 .00 RPM | 2 .35 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000013 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000012437 | 2 retrocopies |
retro_cjac_2534, retro_cjac_2853 ,
|
Dasypus novemcinctus | ENSDNOG00000014823 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008145 | 2 retrocopies | |
Homo sapiens | ENSG00000150787 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015255 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007299 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000017191 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000003880 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004288 | 3 retrocopies |