RetrogeneDB ID: | retro_ogar_609 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873524.1:43387731..43387954(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PTS | ||
Ensembl ID: | ENSOGAG00000017191 | ||
Aliases: | None | ||
Description: | 6-pyruvoyltetrahydropterin synthase [Source:HGNC Symbol;Acc:9689] |
Percent Identity: | 71.43 % |
Parental protein coverage: | 51.72 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | ARVSRCTTFSASHRLYSKHLDDDENLKLFGKCSNPNGHGHNYKVVVTV-HGEIDPVTGMVMNLTDLKKY- |
A.VS.C..FS.SH.LYS..LDD.EN.KLFGKCSNPN.HG.NYKVV..V..GEI.PV.GM.MNLTDLKK.. | |
Retrocopy | AQVSCCIYFSVSHWLYS*NLDDEENIKLFGKCSNPNSHGYNYKVVLPV<RGEIGPVAGMIMNLTDLKKI< |
Parental | MEEAIMK |
MEEAI.K | |
Retrocopy | MEEAILK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000013 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000012437 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000014823 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008145 | 2 retrocopies | |
Homo sapiens | ENSG00000150787 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015255 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007299 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000017191 | 3 retrocopies |
retro_ogar_1718, retro_ogar_2790, retro_ogar_609 ,
|
Pongo abelii | ENSPPYG00000003880 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004288 | 3 retrocopies |