RetrogeneDB ID: | retro_ptro_337 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:123974808..123975181(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PTS | ||
Ensembl ID: | ENSPTRG00000004288 | ||
Aliases: | None | ||
Description: | 6-pyruvoyl tetrahydrobiopterin synthase [Source:UniProtKB/TrEMBL;Acc:H2R4Y8] |
Percent Identity: | 59.84 % |
Parental protein coverage: | 85.52 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | GGRRCQAKVSRRISFSA-SHRL-YSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNL |
G.R..Q..V....SFS..SH.L..SK.LS..E..K.F..CNN.N.H.H.YKVVV...G.IDP.TGMVMN. | |
Retrocopy | GARSHQVLVYSLHSFST>SHWL>HSKSLSIKESIKQF*NCNNANVHEHDYKVVVIAYGGIDPVTGMVMNM |
Parental | ADL-KKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYK |
..L..K..EEAIM.PLDHKNLD.DVPYFADV.S..E.V..YIW.N.QK.LPV.V.YK | |
Retrocopy | INL<HKVTEEAIMKPLDHKNLDLDVPYFADVTSMKEKVVRYIWGNIQKFLPVEVIYK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .30 RPM |
SRP007412_cerebellum | 0 .00 RPM | 3 .30 RPM |
SRP007412_heart | 0 .00 RPM | 3 .03 RPM |
SRP007412_kidney | 0 .00 RPM | 6 .33 RPM |
SRP007412_liver | 0 .00 RPM | 7 .89 RPM |
SRP007412_testis | 0 .11 RPM | 2 .00 RPM |
Species | RetrogeneDB ID |
---|---|
Pongo abelii | retro_pabe_432 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000013 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000012437 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000014823 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008145 | 2 retrocopies | |
Homo sapiens | ENSG00000150787 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015255 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007299 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000017191 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000003880 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004288 | 3 retrocopies |
retro_ptro_2315, retro_ptro_2979, retro_ptro_337 ,
|