RetrogeneDB ID: | retro_cjac_2914 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 7:87990854..87991145(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2I | ||
Ensembl ID: | ENSCJAG00000013249 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2I [Source:HGNC Symbol;Acc:12485] |
Percent Identity: | 92.78 % |
Parental protein coverage: | 61.39 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQA |
MLFKDDYPSSPPKCKFEPPLF.PN.Y.SGT.CLSILEEDKD.RPAITIKQILLGIQELLNEPNIQDPAQA | |
Retrocopy | MLFKDDYPSSPPKCKFEPPLFYPNMYSSGTMCLSILEEDKD*RPAITIKQILLGIQELLNEPNIQDPAQA |
Parental | EAYTIYCQNRVEYEKRVRAQAKKFAPS |
EAYTIYCQNRVEY.KRVRAQAKKFA.S | |
Retrocopy | EAYTIYCQNRVEYVKRVRAQAKKFALS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 13 .82 RPM |
SRP051959_heart | 0 .00 RPM | 13 .37 RPM |
SRP051959_kidney | 0 .02 RPM | 14 .80 RPM |
SRP051959_liver | 0 .00 RPM | 9 .96 RPM |
SRP051959_lung | 0 .02 RPM | 16 .97 RPM |
SRP051959_lymph_node | 0 .02 RPM | 23 .20 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 10 .46 RPM |
SRP051959_spleen | 0 .00 RPM | 20 .88 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000007721 | 1 retrocopy | |
Bos taurus | ENSBTAG00000038866 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000031449 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000013249 | 1 retrocopy |
retro_cjac_2914 ,
|
Cavia porcellus | ENSCPOG00000010431 | 1 retrocopy | |
Equus caballus | ENSECAG00000015831 | 1 retrocopy | |
Felis catus | ENSFCAG00000027291 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000018318 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000008229 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000003654 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000015763 | 1 retrocopy | |
Mus musculus | ENSMUSG00000015120 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008525 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000001428 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000017907 | 11 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000007034 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000021560 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010233 | 3 retrocopies |