RetrogeneDB ID: | retro_cfam_1991 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 9:57463343..57463673(+) | ||
| Located in intron of: | ENSCAFG00000020178 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2I | ||
| Ensembl ID: | ENSCAFG00000031449 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2I [Source:HGNC Symbol;Acc:12485] |
| Percent Identity: | 94.55 % |
| Parental protein coverage: | 78.01 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPS |
| .SGIALSRLAQERKAWRK.HPFGFV.VPTKNPD.TMNLMNWECAIPGKKGTPWEGGLFK.RMLFKDDYPS | |
| Retrocopy | VSGIALSRLAQERKAWRKGHPFGFVGVPTKNPDSTMNLMNWECAIPGKKGTPWEGGLFKVRMLFKDDYPS |
| Parental | SPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIK |
| SPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITI. | |
| Retrocopy | SPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 3 .19 RPM | 23 .94 RPM |
| SRP017611_brain | 0 .87 RPM | 18 .97 RPM |
| SRP017611_kidney | 1 .19 RPM | 13 .08 RPM |
| SRP017611_liver | 0 .15 RPM | 7 .76 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000007721 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000038866 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000031449 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013249 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000010431 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015831 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027291 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000018318 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000008229 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000003654 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015763 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000015120 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008525 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001428 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000017907 | 11 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000007034 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000021560 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000010233 | 3 retrocopies |