RetrogeneDB ID: | retro_cjac_3213 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 9:42164011..42164335(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SSR3 | ||
Ensembl ID: | ENSCJAG00000004643 | ||
Aliases: | None | ||
Description: | signal sequence receptor, gamma (translocon-associated protein gamma) [Source:HGNC Symbol;Acc:11325] |
Percent Identity: | 80.73 % |
Parental protein coverage: | 58.92 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | YKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFL |
..NV...L.....QKRE.AVSKE.T.KLSEADNRKMS.KEKDERILWK.NEVADYEA.TFSIFYNNTLFL | |
Retrocopy | FSNVS*HLFSSTTQKRENAVSKELTQKLSEADNRKMSWKEKDERILWKGNEVADYEA-TFSIFYNNTLFL |
Parental | VLVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK |
V.VIVASFF.LK.FN.TVNYILSISASSGLI.LLSTGSK | |
Retrocopy | VSVIVASFFTLKKFNLTVNYILSISASSGLITLLSTGSK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 58 .38 RPM |
SRP051959_heart | 0 .00 RPM | 46 .50 RPM |
SRP051959_kidney | 0 .00 RPM | 49 .48 RPM |
SRP051959_liver | 0 .00 RPM | 89 .78 RPM |
SRP051959_lung | 0 .00 RPM | 38 .10 RPM |
SRP051959_lymph_node | 0 .02 RPM | 46 .87 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 51 .91 RPM |
SRP051959_spleen | 0 .04 RPM | 56 .18 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003125 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000008870 | 5 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000001517 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004643 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000005898 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000000752 | 2 retrocopies | |
Homo sapiens | ENSG00000114850 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000024038 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000015478 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000016970 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000010589 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000014233 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000015560 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000010578 | 1 retrocopy |