RetrogeneDB ID: | retro_cjac_3238 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 9:85016606..85016962(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MOB4 | ||
| Ensembl ID: | ENSCJAG00000004020 | ||
| Aliases: | None | ||
| Description: | MOB family member 4, phocein [Source:HGNC Symbol;Acc:17261] |
| Percent Identity: | 81.67 % |
| Parental protein coverage: | 52.89 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGV-W |
| MVM.EGTAVLR.NR.GTK.QDFYNWPDES...MDSTL.VQQYIQQN.RADCSNIDKILEP.EGQDE.V.. | |
| Retrocopy | MVMVEGTAVLRWNRLGTKVQDFYNWPDESLEKMDSTLLVQQYIQQNLRADCSNIDKILEPCEGQDESV<M |
| Parental | KYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKEC |
| KYE.L.QFCLELNG..VKLQSECHPDTCTQMTATEQWI.LCA.HKT...C | |
| Retrocopy | KYEYLKQFCLELNGPDVKLQSECHPDTCTQMTATEQWICLCATHKTRVSC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .13 RPM | 19 .26 RPM |
| SRP051959_heart | 0 .26 RPM | 20 .35 RPM |
| SRP051959_kidney | 0 .24 RPM | 17 .64 RPM |
| SRP051959_liver | 0 .11 RPM | 11 .31 RPM |
| SRP051959_lung | 0 .15 RPM | 17 .70 RPM |
| SRP051959_lymph_node | 0 .25 RPM | 16 .60 RPM |
| SRP051959_skeletal_muscle | 0 .15 RPM | 15 .02 RPM |
| SRP051959_spleen | 0 .34 RPM | 17 .31 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Macaca mulatta | retro_mmul_829 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004020 | 2 retrocopies |
retro_cjac_1960, retro_cjac_3238 ,
|
| Cavia porcellus | ENSCPOG00000012746 | 2 retrocopies | |
| Homo sapiens | ENSG00000115540 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009005 | 2 retrocopies | |
| Latimeria chalumnae | ENSLACG00000015430 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016547 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000012305 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000005712 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000272 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000016650 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000013047 | 6 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000017821 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021024 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000001726 | 1 retrocopy |