RetrogeneDB ID: | retro_pabe_3600 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | Un:52274588..52274929(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MOB4 | ||
| Ensembl ID: | ENSPPYG00000013047 | ||
| Aliases: | MOB4, MOB3, MOBKL3, PHOCN, PREI3 | ||
| Description: | MOB-like protein phocein [Source:UniProtKB/Swiss-Prot;Acc:Q5RDB1] |
| Percent Identity: | 68.7 % |
| Parental protein coverage: | 50.22 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | EGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNI-DKI-LEPPEGQDEGVWKYE |
| .GT.V...............WPD.SFDE.DSTLAVQQY..QNIR.....I..KI.LE.PEGQD.G.WKYE | |
| Retrocopy | DGTVVMAEGMAMLRWTRLGTWPDDSFDETDSTLAVQQYMPQNIRVKIAPILTKI<LESPEGQDAGIWKYE |
| Parental | HLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPK |
| HLRQFCLELNGLAVKLQ..CHPDTCTQMTA.EQWIFLCAAHKTP. | |
| Retrocopy | HLRQFCLELNGLAVKLQTKCHPDTCTQMTASEQWIFLCAAHKTPR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 20 .96 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 30 .28 RPM |
| SRP007412_heart | 0 .00 RPM | 19 .18 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .70 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .14 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004020 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000012746 | 2 retrocopies | |
| Homo sapiens | ENSG00000115540 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009005 | 2 retrocopies | |
| Latimeria chalumnae | ENSLACG00000015430 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016547 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000012305 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000005712 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000272 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000016650 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000013047 | 6 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000017821 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021024 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000001726 | 1 retrocopy |