RetrogeneDB ID: | retro_cjac_3466 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | ACFV01180829.1:10419..10590(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000020103 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 52.63 % |
Parental protein coverage: | 60.64 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | FRDQSGQHSETPQASQAWWLMPVIPALWEDEAGGSPEVRSSRPAWPTWQNPISVKNT |
F..Q...H........AW.L.P.IPAL.E.E..GS.EVRSSRPAWPTW..P...K.T | |
Retrocopy | FLSQISVHNNKYRLDWAW*LTPIIPAL*EAEVSGSREVRSSRPAWPTW*TPVATKKT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .04 RPM | 0 .00 RPM |
SRP051959_heart | 0 .26 RPM | 0 .00 RPM |
SRP051959_kidney | 0 .04 RPM | 0 .00 RPM |
SRP051959_liver | 0 .04 RPM | 0 .02 RPM |
SRP051959_lung | 0 .16 RPM | 0 .00 RPM |
SRP051959_lymph_node | 0 .27 RPM | 0 .00 RPM |
SRP051959_skeletal_muscle | 0 .11 RPM | 0 .00 RPM |
SRP051959_spleen | 0 .11 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000020103 | 14 retrocopies | |
Callithrix jacchus | ENSCJAG00000034129 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000027169 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006176 | 2 retrocopies |