RetrogeneDB ID: | retro_cjac_3471 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | ACFV01181108.1:8888..9086(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000020103 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 51.52 % |
Parental protein coverage: | 70.21 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | QRWDRDGVSPFRDQSGQHSETPQASQAWWLMPVIPALWEDEAGGSPEVRSSRPAWPTWQNPISVKN |
Q...R.GV............T.....AWW..PVIPALWE.EAGGSPEV.SS..A.PTW..P.S.KN | |
Retrocopy | QQQGRRGVQSEEQNPWEKKKTRGRGRAWWITPVIPALWEAEAGGSPEVQSSKAA*PTWRKPVSTKN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .29 RPM | 0 .00 RPM |
SRP051959_heart | 0 .09 RPM | 0 .00 RPM |
SRP051959_kidney | 0 .44 RPM | 0 .00 RPM |
SRP051959_liver | 0 .22 RPM | 0 .02 RPM |
SRP051959_lung | 0 .10 RPM | 0 .00 RPM |
SRP051959_lymph_node | 0 .18 RPM | 0 .00 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 0 .00 RPM |
SRP051959_spleen | 0 .08 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000020103 | 14 retrocopies | |
Callithrix jacchus | ENSCJAG00000034129 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000027169 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006176 | 2 retrocopies |