RetrogeneDB ID: | retro_cjac_3740 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | ACFV01197875.1:1187..1420(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000034129 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 56.1 % |
Parental protein coverage: | 80.81 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | PGFKRFSCLSLPSNWDYSWAW-WCLPVIPALWEAKAGRSPEVRSSRSAWAMWRNPISTKNTKI-RLGVPG |
PG.....CL..........AW.W..PVIPALWEAK..RS.E.RS.R.AW..WRNP.STKNTKI..LGV.. | |
Retrocopy | PGNRVRLCLKKKEKQK*I*AWQWLTPVIPALWEAKVSRSLEARSLRPAWPTWRNPVSTKNTKI<QLGV-- |
Parental | VVVHACNPSYLG |
...H.CNPSY.G | |
Retrocopy | -MAHICNPSYSG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 0 .16 RPM |
SRP051959_heart | 0 .02 RPM | 0 .02 RPM |
SRP051959_kidney | 0 .00 RPM | 0 .02 RPM |
SRP051959_liver | 0 .00 RPM | 0 .04 RPM |
SRP051959_lung | 0 .00 RPM | 0 .10 RPM |
SRP051959_lymph_node | 0 .00 RPM | 0 .30 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 0 .04 RPM |
SRP051959_spleen | 0 .00 RPM | 0 .13 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000020103 | 14 retrocopies | |
Callithrix jacchus | ENSCJAG00000034129 | 3 retrocopies |
retro_cjac_3646, retro_cjac_3740 , retro_cjac_3780,
|
Gorilla gorilla | ENSGGOG00000023636 | 1 retrocopy |