RetrogeneDB ID: | retro_cjac_3758 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | ACFV01199181.1:2156..2363(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000035758 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 56.34 % |
| Parental protein coverage: | 69.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | SRDSPA-SASRVAGITGMCYHTQLILMYI-LLETGFHHVGQVDLKLLSSSDLPTLASQSAGITGMSHHAQ |
| S.D.P..SAS.VA..TGMC.H..L....I.L....F.HV.Q..L.LL.SS.....ASQSAGITGMSHHA. | |
| Retrocopy | SSDTPT<SASQVAQNTGMCHHVWLMYFCI>LVKARFCHVAQA*LQLLDSSNPLVSASQSAGITGMSHHAK |
| Parental | P |
| P | |
| Retrocopy | P |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 0 .00 RPM |
| SRP051959_heart | 0 .00 RPM | 0 .05 RPM |
| SRP051959_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP051959_liver | 0 .00 RPM | 0 .00 RPM |
| SRP051959_lung | 0 .00 RPM | 0 .07 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 0 .00 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .00 RPM |
| SRP051959_spleen | 0 .00 RPM | 0 .00 RPM |