RetrogeneDB ID: retro_cjac_3758

Retrocopy location

• Organism: Marmoset (Callithrix jacchus)
• Coordinates: ACFV01199181.1:2156..2363(-)
• Located in intron of: None

Retrocopy information

• Ensembl ID: None
• Aliases: None
• Status: NOVEL

Parental gene information

• Parental gene symbol: None
• Ensembl ID: ENSCJAG00000035758
• Aliases: None
• Description: None

Sequence

>retro_cjac_3758
TCAAGTGATACTCCCACTCAGCATCCCAAGTAGCTCAGAATACAGGAATGTGCCACCATGTCTGGCTAATGTATTTTTGT
ATTTTTAGTAAAGGCAAGGTTTTGTCATGTTGCACAGGCTTGACTTCAACTCCTGGACTCAAGCAATCCACTTGTCTCAG
CCTCCCAAAGTGCTGGGATTACAGGCATGAGCCATCATGCCAAGCCA

Alignment

ORF - retro_cjac_3758 Open Reading Frame is not conserved.

Retrocopy - Parental Gene Alignment summary:

• Percent Identity: 56.34 %
• Parental protein coverage: 69. %
• Number of stop codons detected: 1
• Number of frameshifts detected: 2

Retrocopy - Parental Gene Alignment:

Parental  SRDSPA-SASRVAGITGMCYHTQLILMYI-LLETGFHHVGQVDLKLLSSSDLPTLASQSAGITGMSHHAQ
          S.D.P..SAS.VA..TGMC.H..L....I.L....F.HV.Q..L.LL.SS.....ASQSAGITGMSHHA.
Retrocopy SSDTPT<SASQVAQNTGMCHHVWLMYFCI>LVKARFCHVAQA*LQLLDSSNPLVSASQSAGITGMSHHAK

Parental  P
          P
Retrocopy P

Legend:

• *: Stop codon
• >: Forward frameshift by one nucleotide
• <: Reverse frameshift by one nucleotide

Expression

RNA-Seq

Expression validation based on RNA-Seq data:

Library	Retrocopy expression	Parental gene expression
SRP051959_colon	0.00 RPM	0.00 RPM
SRP051959_heart	0.00 RPM	0.05 RPM
SRP051959_kidney	0.00 RPM	0.00 RPM
SRP051959_liver	0.00 RPM	0.00 RPM
SRP051959_lung	0.00 RPM	0.07 RPM
SRP051959_lymph_node	0.00 RPM	0.00 RPM
SRP051959_skeletal_muscle	0.00 RPM	0.00 RPM
SRP051959_spleen	0.00 RPM	0.00 RPM

ChIP-Seq

Callithrix jacchus was not studied using ChIP-Seq data.

EST

No EST(s) were mapped for retro_cjac_3758 retrocopy.

TSS

Callithrix jacchus was not studied using FANTOM5 data.

Lab

retro_cjac_3758 was not experimentally validated.

Homology

Retrocopy orthology:

Retrocopy retro_cjac_3758 has 0 orthologous retrocopies within eutheria group .

---

Parental genes homology:

Parental genes homology involve 11 parental genes, and 123 retrocopies.

Species	Parental gene accession	Retrocopies number
Callithrix jacchus	ENSCJAG00000008153	10 retrocopies	retro_cjac_3418, retro_cjac_3455, retro_cjac_3485, retro_cjac_3512, retro_cjac_3661, retro_cjac_3690, retro_cjac_3761, retro_cjac_3768, retro_cjac_3792, retro_cjac_3794,
Callithrix jacchus	ENSCJAG00000018676	1 retrocopy	retro_cjac_3468,
Callithrix jacchus	ENSCJAG00000031577	1 retrocopy	retro_cjac_3697,
Callithrix jacchus	ENSCJAG00000031826	24 retrocopies	retro_cjac_3352, retro_cjac_3353, retro_cjac_3357, retro_cjac_3370, retro_cjac_3379, retro_cjac_3384, retro_cjac_3388, retro_cjac_3480, retro_cjac_3493, retro_cjac_3511, retro_cjac_3513, retro_cjac_3517, retro_cjac_3557, retro_cjac_3560, retro_cjac_3567, retro_cjac_3582, retro_cjac_3605, retro_cjac_3634, retro_cjac_3643, retro_cjac_3681, retro_cjac_3729, retro_cjac_3751, retro_cjac_3759, retro_cjac_3784,
Callithrix jacchus	ENSCJAG00000032572	2 retrocopies	retro_cjac_3443, retro_cjac_3779,
Callithrix jacchus	ENSCJAG00000033038	1 retrocopy	retro_cjac_3439,
Callithrix jacchus	ENSCJAG00000035420	16 retrocopies	retro_cjac_3386, retro_cjac_3407, retro_cjac_3449, retro_cjac_3457, retro_cjac_3509, retro_cjac_3531, retro_cjac_3580, retro_cjac_3594, retro_cjac_3635, retro_cjac_3645, retro_cjac_3652, retro_cjac_3657, retro_cjac_3685, retro_cjac_3755, retro_cjac_3760, retro_cjac_3804,
Callithrix jacchus	ENSCJAG00000035758	34 retrocopies	retro_cjac_286, retro_cjac_3341, retro_cjac_3380, retro_cjac_3385, retro_cjac_3409, retro_cjac_3426, retro_cjac_3427, retro_cjac_3444, retro_cjac_3448, retro_cjac_3450, retro_cjac_3494, retro_cjac_3510, retro_cjac_3533, retro_cjac_3534, retro_cjac_3552, retro_cjac_3562, retro_cjac_3579, retro_cjac_3629, retro_cjac_3632, retro_cjac_3650, retro_cjac_3673, retro_cjac_3683, retro_cjac_3695, retro_cjac_3702, retro_cjac_3716, retro_cjac_3738, retro_cjac_3748, retro_cjac_3749, retro_cjac_3752, retro_cjac_3758 , retro_cjac_3769, retro_cjac_3773, retro_cjac_3785, retro_cjac_3797,
Callithrix jacchus	ENSCJAG00000036542	13 retrocopies	retro_cjac_3360, retro_cjac_3431, retro_cjac_3440, retro_cjac_3459, retro_cjac_3538, retro_cjac_3558, retro_cjac_3576, retro_cjac_3615, retro_cjac_3636, retro_cjac_3665, retro_cjac_3691, retro_cjac_3721, retro_cjac_3803,
Callithrix jacchus	ENSCJAG00000037288	16 retrocopies	retro_cjac_3393, retro_cjac_3447, retro_cjac_3475, retro_cjac_3499, retro_cjac_3518, retro_cjac_3519, retro_cjac_3535, retro_cjac_3561, retro_cjac_3603, retro_cjac_3662, retro_cjac_3667, retro_cjac_3703, retro_cjac_3710, retro_cjac_3715, retro_cjac_3727, retro_cjac_3793,
Callithrix jacchus	ENSCJAG00000037961	5 retrocopies	retro_cjac_3573, retro_cjac_3711, retro_cjac_3723, retro_cjac_3766, retro_cjac_3778,