RetrogeneDB ID: | retro_cjac_810 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 10:98833481..98833874(-) | ||
Located in intron of: | ENSCJAG00000009911 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NT5C | ||
Ensembl ID: | ENSCJAG00000014578 | ||
Aliases: | None | ||
Description: | 5', 3'-nucleotidase, cytosolic [Source:HGNC Symbol;Acc:17144] |
Percent Identity: | 59.85 % |
Parental protein coverage: | 66.67 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | GLLRGFRDRFPG-EPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGF-FLDLEPIPGALDAVREMN |
GLLR.FR..F.G.E..V.L.Q.R.FLA.EQYR.L.PDLADKVA...EA..F.F..L...PG...A..EM. | |
Retrocopy | GLLRVFRCGFSG<ELRVTLQQHRSFLAWEQYRTLLPDLADKVAHGCEALSF<FPRLGAQPGR--ALCEMK |
Parental | DLPDTEVFICTSPLLKYDHCVGEKYRWVEQHLGPQFLER-IILTRDKTVVLGDLLIDDKDTIRGHEE |
....TEVFI...PL.KYDHCVGEK.RW.EQHL.P......IILT.DKTV..GDL..DDKDTIRGH.. | |
Retrocopy | HM*NTEVFILHQPLWKYDHCVGEKHRWLEQHLEPWRITE<IILTMDKTVIFGDLTNDDKDTIRGHNQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 5 .59 RPM |
SRP051959_heart | 0 .05 RPM | 4 .39 RPM |
SRP051959_kidney | 0 .09 RPM | 6 .88 RPM |
SRP051959_liver | 0 .02 RPM | 9 .05 RPM |
SRP051959_lung | 0 .00 RPM | 7 .60 RPM |
SRP051959_lymph_node | 0 .07 RPM | 11 .62 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 8 .47 RPM |
SRP051959_spleen | 0 .02 RPM | 7 .31 RPM |
Species | RetrogeneDB ID |
---|---|
Gorilla gorilla | retro_ggor_1109 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009175 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000014578 | 1 retrocopy |
retro_cjac_810 ,
|
Felis catus | ENSFCAG00000031408 | 2 retrocopies | |
Homo sapiens | ENSG00000125458 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000004740 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000017488 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000013985 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000601 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000008619 | 1 retrocopy |