RetrogeneDB ID: | retro_pabe_1195 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 14:74705370..74705771(-) | ||
| Located in intron of: | ENSPPYG00000005971 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NT5C | ||
| Ensembl ID: | ENSPPYG00000008619 | ||
| Aliases: | None | ||
| Description: | 5', 3'-nucleotidase, cytosolic [Source:HGNC Symbol;Acc:17144] |
| Percent Identity: | 62.77 % |
| Parental protein coverage: | 67.66 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | GLLRGFRRRFP-EEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMND |
| GLL.GF...F...E.HV.L.Q.R.FLA..QYR.L.PDL.DKVA...EA.GF.L.L...P.......EM.. | |
| Retrocopy | GLLLGFSHCFS<RELHVTLQQHRSFLAWKQYRTLLPDLVDKVAHGCEALGFSLVLGAQPRRV--FQEMKH |
| Parental | LPDTEVFICTSPLLKYDHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTIRGQEETP |
| ...TEVFI...PL.KYDHCVGEK..WVEQHL.PQ.VE.IILT.DKTVV.GDLL.DDKDTIRGQEE.P | |
| Retrocopy | MQNTEVFILHQPLPKYDHCVGEKHCWVEQHLEPQLVE*IILTMDKTVVFGDLLTDDKDTIRGQEERP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .13 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009175 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014578 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031408 | 2 retrocopies | |
| Homo sapiens | ENSG00000125458 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004740 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000017488 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013985 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000601 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008619 | 1 retrocopy |
retro_pabe_1195 ,
|