RetrogeneDB ID: | retro_pabe_1195 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 14:74705370..74705771(-) | ||
Located in intron of: | ENSPPYG00000005971 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NT5C | ||
Ensembl ID: | ENSPPYG00000008619 | ||
Aliases: | None | ||
Description: | 5', 3'-nucleotidase, cytosolic [Source:HGNC Symbol;Acc:17144] |
Percent Identity: | 62.77 % |
Parental protein coverage: | 67.66 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | GLLRGFRRRFP-EEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMND |
GLL.GF...F...E.HV.L.Q.R.FLA..QYR.L.PDL.DKVA...EA.GF.L.L...P.......EM.. | |
Retrocopy | GLLLGFSHCFS<RELHVTLQQHRSFLAWKQYRTLLPDLVDKVAHGCEALGFSLVLGAQPRRV--FQEMKH |
Parental | LPDTEVFICTSPLLKYDHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTIRGQEETP |
...TEVFI...PL.KYDHCVGEK..WVEQHL.PQ.VE.IILT.DKTVV.GDLL.DDKDTIRGQEE.P | |
Retrocopy | MQNTEVFILHQPLPKYDHCVGEKHCWVEQHLEPQLVE*IILTMDKTVVFGDLLTDDKDTIRGQEERP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .12 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .13 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009175 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000014578 | 1 retrocopy | |
Felis catus | ENSFCAG00000031408 | 2 retrocopies | |
Homo sapiens | ENSG00000125458 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000004740 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000017488 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000013985 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000601 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000008619 | 1 retrocopy |
retro_pabe_1195 ,
|