RetrogeneDB ID: | retro_cpor_371 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_135:1226534..1226725(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NEDD8 | ||
| Ensembl ID: | ENSCPOG00000010930 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.18 % |
| Parental protein coverage: | 79.01 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | LFLKVVTLT-GKEIEIDIEPTDKVERIKERVEE-KEGIPPQQQRLIYSGKQMNDEKTAADYKILGG |
| ...KV..LT.GK.IE..IEPTDKVER.KE..EE.....PPQQQRL.Y.GKQM.DEKTAADY.ILGG | |
| Retrocopy | MLMKVKRLT>GKQIETGIEPTDKVERVKEQ-EE>RQRAPPQQQRLSYGGKQMHDEKTAADYEILGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 38 .71 RPM |
| SRP017611_kidney | 0 .00 RPM | 39 .26 RPM |
| SRP017611_liver | 0 .22 RPM | 25 .90 RPM |
| SRP040447_lung | 0 .00 RPM | 30 .79 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 40 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy |
retro_cpor_371 ,
|
| Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy |