RetrogeneDB ID: | retro_cjac_4064 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | X:52388688..52388922(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCJAG00000031713 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000006876 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 93.67 % |
Parental protein coverage: | 96.34 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | KVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLAL |
KVKTLTGKEI.IDIEPTDKVERIKERVEEK.GIPPQQQRLIYSGKQMNDEKT.ADYKILGGSVLHL.LAL | |
Retrocopy | KVKTLTGKEIKIDIEPTDKVERIKERVEEKQGIPPQQQRLIYSGKQMNDEKTTADYKILGGSVLHLMLAL |
Parental | RGGGGGLRQ |
R.GGGGLRQ | |
Retrocopy | R-GGGGLRQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 10 .74 RPM |
SRP051959_heart | 0 .00 RPM | 16 .89 RPM |
SRP051959_kidney | 0 .04 RPM | 17 .13 RPM |
SRP051959_liver | 0 .00 RPM | 16 .70 RPM |
SRP051959_lung | 0 .00 RPM | 14 .82 RPM |
SRP051959_lymph_node | 0 .00 RPM | 12 .81 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 18 .37 RPM |
SRP051959_spleen | 0 .00 RPM | 16 .32 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy |
retro_cjac_4064 ,
|
Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000011640 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000018391 | 2 retrocopies | |
Homo sapiens | ENSG00000129559 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000029409 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000009104 | 4 retrocopies |