RetrogeneDB ID: | retro_ggor_261 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:86511123..86511346(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NEDD8 | ||
| Ensembl ID: | ENSGGOG00000016105 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.58 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQ-MNDEKTAADYKILGGSVLHLVLALRG |
| TLTGKE.EIDIEPTDKVE.IKE.VEEKEGI.P.QQ.........MNDEKTAADYKILGGSVLHLVLALRG | |
| Retrocopy | TLTGKETEIDIEPTDKVE*IKEHVEEKEGI-PPQQQRLIYSGK>MNDEKTAADYKILGGSVLHLVLALRG |
| Parental | GGGLRQ |
| GGGLRQ | |
| Retrocopy | GGGLRQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 17 .46 RPM | 78 .36 RPM |
| SRP007412_cerebellum | 5 .48 RPM | 32 .46 RPM |
| SRP007412_heart | 4 .60 RPM | 25 .52 RPM |
| SRP007412_kidney | 4 .82 RPM | 42 .52 RPM |
| SRP007412_liver | 3 .14 RPM | 23 .05 RPM |
| SRP007412_testis | 5 .18 RPM | 26 .94 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_180 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy |
retro_ggor_261 ,
|
| Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy |