RetrogeneDB ID: | retro_ggor_261 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:86511123..86511346(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NEDD8 | ||
Ensembl ID: | ENSGGOG00000016105 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.58 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQ-MNDEKTAADYKILGGSVLHLVLALRG |
TLTGKE.EIDIEPTDKVE.IKE.VEEKEGI.P.QQ.........MNDEKTAADYKILGGSVLHLVLALRG | |
Retrocopy | TLTGKETEIDIEPTDKVE*IKEHVEEKEGI-PPQQQRLIYSGK>MNDEKTAADYKILGGSVLHLVLALRG |
Parental | GGGLRQ |
GGGLRQ | |
Retrocopy | GGGLRQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 17 .46 RPM | 78 .36 RPM |
SRP007412_cerebellum | 5 .48 RPM | 32 .46 RPM |
SRP007412_heart | 4 .60 RPM | 25 .52 RPM |
SRP007412_kidney | 4 .82 RPM | 42 .52 RPM |
SRP007412_liver | 3 .14 RPM | 23 .05 RPM |
SRP007412_testis | 5 .18 RPM | 26 .94 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_180 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000038842 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000012097 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001228 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000006876 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000010930 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016105 | 1 retrocopy |
retro_ggor_261 ,
|
Monodelphis domestica | ENSMODG00000003254 | 1 retrocopy |