RetrogeneDB ID: | retro_cpor_652 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_21:9990147..9990513(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RAB18 | ||
Ensembl ID: | ENSCPOG00000002234 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 79.03 % |
Parental protein coverage: | 58.94 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | ILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHS-MLFIEASAK |
.LVYDVTRRDTF..LDNWLNE..T.CT.ND..N.LVGN.IDKENREVDRNEGLKF..K.S.MLFIE.SAK | |
Retrocopy | VLVYDVTRRDTFAELDNWLNEI*THCTKNDTINVLVGNQIDKENREVDRNEGLKFSQKDS<MLFIETSAK |
Parental | -TCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHMEESHGGGACGGYCSVL |
.....VQCAF.ELVEKIIQTPGLWESENQNKGVKLSHMEESHG.GACGG...VL | |
Retrocopy | >SFGSVQCAFGELVEKIIQTPGLWESENQNKGVKLSHMEESHGEGACGGVLIVL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 43 .94 RPM |
SRP017611_kidney | 0 .00 RPM | 44 .39 RPM |
SRP017611_liver | 0 .00 RPM | 39 .00 RPM |
SRP040447_lung | 0 .00 RPM | 47 .77 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 25 .45 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000009871 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000005565 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000002234 | 2 retrocopies |
retro_cpor_633, retro_cpor_652 ,
|
Dipodomys ordii | ENSDORG00000014338 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000008253 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000022307 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000028015 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000018972 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000007613 | 1 retrocopy |