RetrogeneDB ID: | retro_cpor_829 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_3:27555305..27555484(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C10ORF32 | ||
Ensembl ID: | ENSCPOG00000021622 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 60.66 % |
Parental protein coverage: | 52.63 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | ELLGQAARNMVLQEDAILHSEDSL-RKMAIITTHLQYQQEAIQKNVEQSSDLQDQLKHLLK |
.LL.QAA..M.L.ED..LHS..S..R.MA..TTHLQY.QE.IQ...E.SSDLQD.L.HLL. | |
Retrocopy | QLLSQAA*SMIL*EDTVLHSKGSQ<REMATVTTHLQYKQEGIQMDTEWSSDLQD*LNHLLQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 3 .85 RPM |
SRP017611_kidney | 0 .00 RPM | 4 .50 RPM |
SRP017611_liver | 0 .00 RPM | 3 .66 RPM |
SRP040447_lung | 0 .00 RPM | 6 .51 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 13 .91 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000021622 | 1 retrocopy |
retro_cpor_829 ,
|
Loxodonta africana | ENSLAFG00000020646 | 4 retrocopies | |
Macropus eugenii | ENSMEUG00000013119 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000000834 | 1 retrocopy |