RetrogeneDB ID: | retro_pcap_87 | ||
Retrocopy location | Organism: | Hyrax (Procavia capensis) | |
| Coordinates: | GeneScaffold_5185:23194..23410(+) | ||
| Located in intron of: | ENSPCAG00000008555 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPCAG00000000834 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 81.82 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | KGLLTEKVNTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAI |
| KGLLT..VN.CG.DVI.LT.....GS.S..LLG.AA.NMV..EDA.L.SEDSLR.MA.ITTHLQ..QEAI | |
| Retrocopy | KGLLTLEVNSCGADVIMLT*PMMNGSWSTKLLGKAA*NMVPWEDATLCSEDSLREMAMITTHLQNHQEAI |
| Parental | QK |
| .K | |
| Retrocopy | *K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000021622 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000020646 | 4 retrocopies | |
| Macropus eugenii | ENSMEUG00000013119 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000000834 | 1 retrocopy |
retro_pcap_87 ,
|