RetrogeneDB ID: | retro_pcap_87 | ||
Retrocopylocation | Organism: | Hyrax (Procavia capensis) | |
Coordinates: | GeneScaffold_5185:23194..23410(+) | ||
Located in intron of: | ENSPCAG00000008555 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPCAG00000000834 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 66.67 % |
Parental protein coverage: | 81.82 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | KGLLTEKVNTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAI |
KGLLT..VN.CG.DVI.LT.....GS.S..LLG.AA.NMV..EDA.L.SEDSLR.MA.ITTHLQ..QEAI | |
Retrocopy | KGLLTLEVNSCGADVIMLT*PMMNGSWSTKLLGKAA*NMVPWEDATLCSEDSLREMAMITTHLQNHQEAI |
Parental | QK |
.K | |
Retrocopy | *K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000021622 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000020646 | 4 retrocopies | |
Macropus eugenii | ENSMEUG00000013119 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000000834 | 1 retrocopy |
retro_pcap_87 ,
|