RetrogeneDB ID: | retro_lafr_1177 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_80:5356305..5356464(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSLAFG00000020646 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.13 % |
Parental protein coverage: | 50.48 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | RNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK |
RNM.LQEDAILH..DSLR.MAIITTHLQYQQEAI.KNVEQSS.L.DQ...LLK | |
Retrocopy | RNMILQEDAILHTKDSLRTMAIITTHLQYQQEAIWKNVEQSSALRDQFDYLLK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000021622 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000020646 | 4 retrocopies | |
Macropus eugenii | ENSMEUG00000013119 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000032692 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000000834 | 1 retrocopy |