RetrogeneDB ID: | retro_dnov_2045 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_44355:4574..4799(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPA3 | ||
| Ensembl ID: | ENSDNOG00000011718 | ||
| Aliases: | None | ||
| Description: | replication protein A3, 14kDa [Source:HGNC Symbol;Acc:10291] |
| Percent Identity: | 89.33 % |
| Parental protein coverage: | 79.79 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MVDVMELPKWRINASMLAQFIDRPVCFVGRLEKIHPTEKMFILSDGEGKNGTIELMEPLDEEISGIVEVV |
| MV.VMEL.KWRIN.SMLAQFIDRPVCFVGRLEKIHPT.KMFILSDGEGKNGTIELMEPLDEEISGIVEVV | |
| Retrocopy | MVNVMELLKWRINTSMLAQFIDRPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVV |
| Parental | GRVTN |
| ....N | |
| Retrocopy | DEQGN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 2 .33 RPM | 7 .58 RPM |
| SRP012922_cerebellum | 2 .06 RPM | 8 .66 RPM |
| SRP012922_heart | 1 .86 RPM | 3 .71 RPM |
| SRP012922_kidney | 2 .74 RPM | 6 .84 RPM |
| SRP012922_liver | 0 .93 RPM | 3 .87 RPM |
| SRP012922_lung | 3 .36 RPM | 9 .77 RPM |
| SRP012922_quadricep_muscle | 1 .73 RPM | 4 .67 RPM |
| SRP012922_spleen | 3 .43 RPM | 12 .25 RPM |