RetrogeneDB ID: | retro_mmus_413 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:9802307..9802553(-) | ||
| Located in intron of: | ENSMUSG00000025915 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000046334 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpa3 | ||
| Ensembl ID: | ENSMUSG00000012483 | ||
| Aliases: | Rpa3, 14kDa, C330026P08Rik | ||
| Description: | replication protein A3 [Source:MGI Symbol;Acc:MGI:1915490] |
| Percent Identity: | 91.46 % |
| Parental protein coverage: | 67.77 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MEDIMQLPKARVNASMLPQYIDRPVCFVGKLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVV |
| M.DIM..PKAR.N.SMLPQYID..VCFVGKLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVV | |
| Retrocopy | MKDIMGHPKARINTSMLPQYIDQSVCFVGKLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVV |
| Parental | GKVTAKATVLCA |
| GKVTAKATVLCA | |
| Retrocopy | GKVTAKATVLCA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 3 .50 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 2 .95 RPM |
| SRP007412_heart | 0 .06 RPM | 4 .42 RPM |
| SRP007412_kidney | 0 .06 RPM | 4 .25 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .85 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .97 RPM |