RetrogeneDB ID: | retro_ecab_819 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 4:84307775..84307982(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPA3 | ||
| Ensembl ID: | ENSECAG00000007680 | ||
| Aliases: | None | ||
| Description: | replication protein A3, 14kDa [Source:HGNC Symbol;Acc:10291] |
| Percent Identity: | 65.75 % |
| Parental protein coverage: | 57.85 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | MADVMELPKSRIN-ASLLAQFID-RPVCFVG-RLEKIHPTGKMFILSDGEGKNVTIELMEPLDEEISGIV |
| M..VMEL.K..I...SLLAQ.ID..P.CF.G.RLEKIHPTG.M.ILSD.EGK..T.ELMEPLDEEIS.I. | |
| Retrocopy | M*QVMELAKAHIS<TSLLAQYID<LPICFMG<RLEKIHPTGIMLILSDREGKKETDELMEPLDEEISRIA |
| Parental | EVV |
| ... | |
| Retrocopy | LIL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 3 .25 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 9 .14 RPM |
| SRP021940_embryo | 0 .00 RPM | 13 .12 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 5 .15 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 4 .15 RPM |
| SRP021940_testis | 0 .00 RPM | 16 .24 RPM |