RetrogeneDB ID: | retro_dnov_2168 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_5210:90570..90954(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RNF149 | ||
Ensembl ID: | ENSDNOG00000011956 | ||
Aliases: | None | ||
Description: | ring finger protein 149 [Source:HGNC Symbol;Acc:23137] |
Percent Identity: | 67.67 % |
Parental protein coverage: | 53.06 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | VCIE-NFKVKDVIRILPCKHIF-HRTCIDPWLLDHRTCPMCKLDVIKALGYWGEPEDVQEMPASESTPGS |
.CIE.NF..KD..R.LPCKHIF.HRT.ID..L.D..T...C..DV.KALGY.GEPEDV.EMP..ESTPGS | |
Retrocopy | LCIE<NFLKKDITRLLPCKHIF<HRTYIDL*L*DR*TLSVCNFDVVKALGYRGEPEDVREMPVRESTPGS |
Parental | ASAANLSTALQDDDRSDRNNLPSSSTNESVSQVNASFKE-DAGENTALLETGSSDPQRGGPVS |
.SAANLS..LQ.DDRSD......S....SV.QVNASFKE.DAGE..ALLETG.SDPQRGGPVS | |
Retrocopy | VSAANLSHTLQNDDRSDTIYHDLST-GDSVLQVNASFKE<DAGEHPALLETGGSDPQRGGPVS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 28 .78 RPM |
SRP012922_cerebellum | 0 .00 RPM | 3 .44 RPM |
SRP012922_heart | 0 .00 RPM | 3 .71 RPM |
SRP012922_kidney | 0 .00 RPM | 25 .46 RPM |
SRP012922_liver | 0 .00 RPM | 8 .98 RPM |
SRP012922_lung | 0 .00 RPM | 35 .43 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 6 .58 RPM |
SRP012922_spleen | 0 .00 RPM | 35 .83 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000012057 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000011956 | 3 retrocopies |
retro_dnov_2168 , retro_dnov_534, retro_dnov_580,
|
Dasypus novemcinctus | ENSDNOG00000014687 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000014821 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000007110 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000013946 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000016450 | 1 retrocopy |