RetrogeneDB ID: | retro_dnov_2203 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_55420:7114..7563(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COQ10B | ||
| Ensembl ID: | ENSDNOG00000003229 | ||
| Aliases: | None | ||
| Description: | coenzyme Q10 homolog B (S. cerevisiae) [Source:HGNC Symbol;Acc:25819] |
| Percent Identity: | 84.77 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MAARRALRRVVPGCCPKAGAATGARAPAQESARNVRYLASCGILMSRTLPLHTSIVPKEMYARTFFKIAA |
| MAAR.ALRRVV.GCCPKA.AAT.A.AP.QESA.NVRYL.SCGILMSRTLPLH.S.V.KEMYARTFFKIAA | |
| Retrocopy | MAARKALRRVVSGCCPKARAATRAPAPVQESAWNVRYLTSCGILMSRTLPLHSSVVSKEMYARTFFKIAA |
| Parental | PL-INKRKEY-ERRIIGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTS |
| PL.INKRKEY.ER.II.YS.QE.YDVVSGVEDYKHFVPWCKKS.VISKRSGYCKT.LEIG.PPVL.RYT. | |
| Retrocopy | PL<INKRKEYSERKIIVYSIQEIYDVVSGVEDYKHFVPWCKKSNVISKRSGYCKTQLEIGLPPVLKRYTL |
| Parental | VVTLVKPHLVK |
| VV.LVKPHLVK | |
| Retrocopy | VVILVKPHLVK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 11 .67 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 12 .92 RPM |
| SRP012922_heart | 0 .00 RPM | 13 .46 RPM |
| SRP012922_kidney | 0 .00 RPM | 17 .25 RPM |
| SRP012922_liver | 0 .00 RPM | 16 .41 RPM |
| SRP012922_lung | 0 .00 RPM | 12 .37 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 7 .27 RPM |
| SRP012922_spleen | 0 .00 RPM | 12 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000004659 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000005807 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003971 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000003229 | 2 retrocopies |
retro_dnov_1571, retro_dnov_2203 ,
|
| Dipodomys ordii | ENSDORG00000004090 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000001626 | 1 retrocopy | |
| Felis catus | ENSFCAG00000022385 | 1 retrocopy | |
| Homo sapiens | ENSG00000115520 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023373 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000865 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010488 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000012281 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000025981 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006871 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000010091 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000013045 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000012772 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014456 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012642 | 2 retrocopies |