RetrogeneDB ID: | retro_mdom_600 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:472571773..472572187(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COQ10B | ||
| Ensembl ID: | ENSMODG00000012281 | ||
| Aliases: | None | ||
| Description: | coenzyme Q10 homolog B (S. cerevisiae) [Source:HGNC Symbol;Acc:25819] |
| Percent Identity: | 73.57 % |
| Parental protein coverage: | 57.02 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | RTFFKIAAPLINKRKEYSERRIIGYSMQEMYDVVSGMEDYKNFVPWCKKSDVISKRSGYCKTR-LEIGFP |
| R...............YSERRI.GYSMQEMYDVVSGMEDYKNFVP..KKSDVISK.SGYCKT..LEIGFP | |
| Retrocopy | RSLQELSSKFXXXXNDYSERRILGYSMQEMYDVVSGMEDYKNFVPCGKKSDVISKKSGYCKTM>LEIGFP |
| Parental | PVLERYTSIVTLVKPHLVKASCTDGKLFNH-LETVWRFSPGLPGYPRTCTVDFSISFEFRSLLHSQLATL |
| .VLE.YTSIVTLVKPHLVKASCTDGKL.NH.L..VW.FS..LP..P.TCTV.FSISFEF.SLLHSQ..TL | |
| Retrocopy | SVLE*YTSIVTLVKPHLVKASCTDGKLSNH<LKIVWCFSSDLPR*PMTCTVNFSISFEFHSLLHSQFFTL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .20 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000004659 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000005807 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003971 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000003229 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000004090 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000001626 | 1 retrocopy | |
| Felis catus | ENSFCAG00000022385 | 1 retrocopy | |
| Homo sapiens | ENSG00000115520 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023373 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000865 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010488 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000012281 | 1 retrocopy |
retro_mdom_600 ,
|
| Mus musculus | ENSMUSG00000025981 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006871 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000010091 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000013045 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000012772 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014456 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012642 | 2 retrocopies |