RetrogeneDB ID: | retro_dnov_286 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_3290:296373..296713(-) | ||
| Located in intron of: | ENSDNOG00000014516 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SKP1 | ||
| Ensembl ID: | ENSDNOG00000012999 | ||
| Aliases: | None | ||
| Description: | S-phase kinase-associated protein 1 [Source:HGNC Symbol;Acc:10899] |
| Percent Identity: | 73.5 % |
| Parental protein coverage: | 70.55 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | TMLEDLGMDDEGDDDPVPLPNVNAAILKKV-IQWCTHHKDDPPPPEDDENKEKR-TDDIPVWDQEFLKVD |
| T..ED..M.D...DDPVPLPNVN.AI..K..IQ..TH.KDDPPPPE.DENKEK..TD.IP.WDQEFLKV. | |
| Retrocopy | TSVEDVRMEDR-EDDPVPLPNVNTAIFLKI<IQ*YTHYKDDPPPPEGDENKEKQ<TDNIPIWDQEFLKVS |
| Parental | QGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKN |
| QGTL.E.ILA.N.LDIK.LL.VTCKTVANM.KGKTPEE..KTFNIKN | |
| Retrocopy | QGTLLEVILATNSLDIKDLLAVTCKTVANMVKGKTPEELLKTFNIKN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 74 .48 RPM |
| SRP012922_cerebellum | 0 .14 RPM | 151 .08 RPM |
| SRP012922_heart | 0 .00 RPM | 75 .87 RPM |
| SRP012922_kidney | 0 .00 RPM | 81 .32 RPM |
| SRP012922_liver | 0 .00 RPM | 46 .29 RPM |
| SRP012922_lung | 0 .00 RPM | 82 .62 RPM |
| SRP012922_quadricep_muscle | 0 .17 RPM | 119 .26 RPM |
| SRP012922_spleen | 0 .00 RPM | 93 .74 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017810 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000000994 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013613 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000012999 | 9 retrocopies |
retro_dnov_1216, retro_dnov_1338, retro_dnov_2433, retro_dnov_2526, retro_dnov_2647, retro_dnov_281, retro_dnov_286 , retro_dnov_389, retro_dnov_776,
|
| Echinops telfairi | ENSETEG00000007560 | 5 retrocopies | |
| Felis catus | ENSFCAG00000031140 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000022930 | 7 retrocopies | |
| Microcebus murinus | ENSMICG00000017588 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000022919 | 13 retrocopies | |
| Monodelphis domestica | ENSMODG00000014168 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000022505 | 10 retrocopies | |
| Pongo abelii | ENSPPYG00000015783 | 7 retrocopies | |
| Vicugna pacos | ENSVPAG00000001583 | 1 retrocopy |