RetrogeneDB ID: | retro_dnov_510 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_551:100247..100442(-) | ||
| Located in intron of: | ENSDNOG00000017821 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BOLA3 | ||
| Ensembl ID: | ENSDNOG00000008309 | ||
| Aliases: | None | ||
| Description: | bolA homolog 3 (E. coli) [Source:HGNC Symbol;Acc:24415] |
| Percent Identity: | 63.64 % |
| Parental protein coverage: | 92.96 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | GPAAAAPLLRGIRGLPLLHSGHRMFASQTEGELKVTQILKEKFPRATTIKVTDISEGCGAMYEIKI |
| G...A.PL...I.GL.LLHSGH.MF.SQT.G...VT.I..EKFP.ATTIKVT.IS.G.G.M.EIKI | |
| Retrocopy | GRLPAGPLHHRIPGLSLLHSGHQMFTSQT*GA-QVTKIFQEKFPPATTIKVTGISGGYGVMCEIKI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 4 .47 RPM |
| SRP012922_cerebellum | 0 .27 RPM | 1 .24 RPM |
| SRP012922_heart | 0 .00 RPM | 5 .80 RPM |
| SRP012922_kidney | 0 .00 RPM | 1 .92 RPM |
| SRP012922_liver | 0 .00 RPM | 2 .63 RPM |
| SRP012922_lung | 0 .00 RPM | 2 .44 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 2 .42 RPM |
| SRP012922_spleen | 0 .00 RPM | 3 .09 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000008739 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000017844 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008309 | 2 retrocopies |
retro_dnov_2474, retro_dnov_510 ,
|
| Myotis lucifugus | ENSMLUG00000016364 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000007813 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000045160 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016658 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003502 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000001754 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000008291 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000006698 | 3 retrocopies |