RetrogeneDB ID: | retro_sscr_750 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 4:19917157..19917389(+) | ||
| Located in intron of: | ENSSSCG00000005997 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BOLA3 | ||
| Ensembl ID: | ENSSSCG00000008291 | ||
| Aliases: | None | ||
| Description: | bolA homolog 3 (E. coli) [Source:HGNC Symbol;Acc:24415] |
| Percent Identity: | 67.5 % |
| Parental protein coverage: | 70.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | MAAWSPAAAAPLLRGSR-GLPLLHSAQRMFASQTEGERKVTQILK-EKFPRATAIKVTDISGGCG-AMYE |
| MA.WS.A...P.L.G...GLPLLH.A..MFA.Q.EGE.K.TQILK.EKFP.ATA.KVTDISGGCG.AMYE | |
| Retrocopy | MATWSLATTVPVLHGDL>GLPLLHCAWWMFALQAEGELKETQILK>EKFPQATANKVTDISGGCG<AMYE |
| Parental | IQIESEEFKE |
| I.I..EEF.. | |
| Retrocopy | IPIKLEEFMD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 39 .55 RPM |
| SRP014902_testis | 0 .00 RPM | 20 .37 RPM |
| SRP018288_heart | 0 .00 RPM | 51 .37 RPM |
| SRP018288_kidney | 0 .00 RPM | 64 .13 RPM |
| SRP018288_liver | 0 .00 RPM | 32 .94 RPM |
| SRP018288_lung | 0 .00 RPM | 32 .18 RPM |
| SRP018856_adipose | 0 .00 RPM | 44 .39 RPM |
| SRP035408_brain | 0 .00 RPM | 44 .94 RPM |
| SRP035408_liver | 0 .00 RPM | 37 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000008739 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000017844 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008309 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016364 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000007813 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000045160 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016658 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003502 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000001754 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000008291 | 1 retrocopy |
retro_sscr_750 ,
|
| Tursiops truncatus | ENSTTRG00000006698 | 3 retrocopies |