RetrogeneDB ID: | retro_cjac_1112 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 13:88931400..88931720(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BOLA3 | ||
Ensembl ID: | ENSCJAG00000017844 | ||
Aliases: | None | ||
Description: | bolA homolog 3 (E. coli) [Source:HGNC Symbol;Acc:24415] |
Percent Identity: | 65.45 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MAAWSPAAAAPLLRGIRGLPLHCVHRMFASQTEGELRVTQILKEKFPQATAIKVTDISGGCGAMYEIKI- |
M.AWSPAAA.PL...IRGL.LHCVH.MFASQTE.ELR..QILK..F......K........G.....K.. | |
Retrocopy | MVAWSPAAAVPLFCRIRGLLLHCVHHMFASQTERELRLIQILK-SFLEIQLSKSLTFQEVVGRCIKLKL< |
Parental | ESEEFKEKRTVQQHQMVNQALKEEIKGMHGLRIFTSVPKH |
ES.EFK.K.TVQQHQMVNQALKEEI.GMHGL.IFTSVPKH | |
Retrocopy | ES*EFK-KITVQQHQMVNQALKEEIEGMHGLWIFTSVPKH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 0 .98 RPM |
SRP051959_heart | 0 .00 RPM | 2 .39 RPM |
SRP051959_kidney | 0 .00 RPM | 2 .44 RPM |
SRP051959_liver | 0 .00 RPM | 1 .39 RPM |
SRP051959_lung | 0 .00 RPM | 0 .59 RPM |
SRP051959_lymph_node | 0 .00 RPM | 0 .71 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 2 .07 RPM |
SRP051959_spleen | 0 .00 RPM | 0 .59 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000008739 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000017844 | 1 retrocopy |
retro_cjac_1112 ,
|
Dasypus novemcinctus | ENSDNOG00000008309 | 2 retrocopies | |
Homo sapiens | ENSG00000163170 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000024505 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000016364 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015207 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000007813 | 1 retrocopy | |
Mus musculus | ENSMUSG00000045160 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000320 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016658 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000003502 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012285 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000012078 | 3 retrocopies | |
Sorex araneus | ENSSARG00000001754 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000008291 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000006698 | 3 retrocopies |