RetrogeneDB ID: | retro_dnov_702 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_992:43501..43945(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C1QBP | ||
| Ensembl ID: | ENSDNOG00000008887 | ||
| Aliases: | None | ||
| Description: | complement component 1, q subcomponent binding protein [Source:HGNC Symbol;Acc:1243] |
| Percent Identity: | 70.51 % |
| Parental protein coverage: | 55.04 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | KVTVTFNINNSIPPPFDGEEEPSQGQKAEEQE-ELMSTPNFVVEVIKNDGKKALVLDCHYPEDEVGKEDE |
| K...TFNI..S..PP....EE....QKAEEQE.ELMS.PN.V.EV....GKKALVL.CH.PE.E.GKE.E | |
| Retrocopy | KIVATFNIHGSM-PPPLDREE----QKAEEQEPELMSSPNCVAEVVRKGGKKALVLGCHFPEAEFGKEEE |
| Parental | DESDIFSIREVSFQSTGEPDWKDTNYTLNTDSLDWALYDHLMDFLADRGVDN-TFADELVELSTALEHQE |
| .E.DIFSIREVSFQST.EP.WKDTN.TL.TDSLDWAL.DHLMDFL.DRGVD...FADELVELS.A.EHQE | |
| Retrocopy | -ERDIFSIREVSFQSTREPGWKDTNPTLHTDSLDWAL*DHLMDFLVDRGVDK<NFADELVELSIAPEHQE |
| Parental | YIT-FLEDLKSFVKSQ |
| Y.T.FLEDL.S.V.SQ | |
| Retrocopy | YVT>FLEDLRSCVQSQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 78 .18 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 40 .97 RPM |
| SRP012922_heart | 0 .00 RPM | 49 .42 RPM |
| SRP012922_kidney | 0 .00 RPM | 59 .96 RPM |
| SRP012922_liver | 0 .00 RPM | 30 .81 RPM |
| SRP012922_lung | 0 .00 RPM | 36 .35 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 61 .44 RPM |
| SRP012922_spleen | 0 .00 RPM | 38 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006043 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000011352 | 6 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008887 | 3 retrocopies |
retro_dnov_1151, retro_dnov_1946, retro_dnov_702 ,
|
| Felis catus | ENSFCAG00000026474 | 3 retrocopies | |
| Homo sapiens | ENSG00000108561 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000002745 | 5 retrocopies | |
| Macropus eugenii | ENSMEUG00000014882 | 13 retrocopies | |
| Macaca mulatta | ENSMMUG00000006592 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009081 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000001610 | 5 retrocopies | |
| Ochotona princeps | ENSOPRG00000013150 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007870 | 6 retrocopies | |
| Pan troglodytes | ENSPTRG00000008631 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002466 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000002441 | 2 retrocopies |