RetrogeneDB ID: | retro_dord_771 | ||
Retrocopy location | Organism: | Kangaroo rat (Dipodomys ordii) | |
| Coordinates: | scaffold_87970:4470..4713(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDORG00000015501 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 88.89 % |
| Parental protein coverage: | 66.12 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSNANTGLIVSLEKELAPLF |
| L.PGFLSTFALA.DQGSKLGLSKNKSIICYYNTYQVVQFN.LPL.VSFI.SSNANTGLIVSLEKELAPL. | |
| Retrocopy | LTPGFLSTFALAADQGSKLGLSKNKSIICYYNTYQVVQFNHLPLMVSFITSSNANTGLIVSLEKELAPLL |
| Parental | E-ELIKVVEVS |
| E..LIKVVE.S | |
| Retrocopy | EKKLIKVVEIS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000995 | 4 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000013153 | 7 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015196 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000013304 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000025421 | 14 retrocopies | |
| Dipodomys ordii | ENSDORG00000015501 | 5 retrocopies | |
| Equus caballus | ENSECAG00000013569 | 1 retrocopy | |
| Homo sapiens | ENSG00000109270 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001132 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000015740 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006786 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000006830 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000020688 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000091512 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013684 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000014955 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000016310 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000017674 | 1 retrocopy |