RetrogeneDB ID: | retro_ecab_138 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 1:98867223..98867583(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LAMTOR3 | ||
| Ensembl ID: | ENSECAG00000013569 | ||
| Aliases: | None | ||
| Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [Source:HGNC Symbol;Acc:15606] |
| Percent Identity: | 61.6 % |
| Parental protein coverage: | 98.39 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | QDLKRFLYKKLPSVEGLHAIVVSDRDGVP-VIKVANDNAPEHALRPGFLSTFALATDQ-GSKLGLSKNKS |
| .DL..FL..K...VEG..A..VSD.DGV..VI.VAN..AP.HALRP.FL..F.LATDQ.GSKLGLSKN.S | |
| Retrocopy | KDLT*FLCQKQLRVEGFQATAVSDGDGVG<VITVANASAPDHALRPSFLPAFVLATDQ<GSKLGLSKNRS |
| Parental | IICYYNTYQVVQFNRLPLVVSFIASSNANTGLI-VSLEKELAPLFEELRQVVEVS |
| IIC..NT.QVV.F..LPL.VS....S........VS.EKE.APLFE.LRQ.VEVS | |
| Retrocopy | IICSFNT*QVVPFKHLPL-VSSFTASSKANAAL<VSREKERAPLFEDLRQAVEVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 1 .95 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 4 .05 RPM |
| SRP021940_embryo | 0 .13 RPM | 5 .06 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 6 .64 RPM |
| SRP021940_synovial_membrane | 0 .03 RPM | 4 .61 RPM |
| SRP021940_testis | 0 .51 RPM | 8 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000995 | 4 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000013153 | 7 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015196 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000013304 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000025421 | 14 retrocopies | |
| Dipodomys ordii | ENSDORG00000015501 | 5 retrocopies | |
| Equus caballus | ENSECAG00000013569 | 1 retrocopy |
retro_ecab_138 ,
|
| Homo sapiens | ENSG00000109270 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001132 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000015740 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006786 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000006830 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000020688 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000091512 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013684 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000014955 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000016310 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000017674 | 1 retrocopy |