RetrogeneDB ID: | retro_ecab_711 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 3:32072072..32072329(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SEC61B | ||
| Ensembl ID: | ENSECAG00000026930 | ||
| Aliases: | None | ||
| Description: | Sec61 beta subunit [Source:HGNC Symbol;Acc:16993] |
| Percent Identity: | 52.87 % |
| Parental protein coverage: | 88.54 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | VGSSGRSPSKAVAARAAGSTVRQRKNASC-GTRSAGRTTSAGTGGMWRFYTED-SPGLKVGPVPVLVMSL |
| VG.....P.....A...GS........S..GT.SAGRTT.AG.GG..R..TE..SPGL.VGPVP.LV.SL | |
| Retrocopy | VGRALVDPHRLLGALPVGSRAAPGRGRSRRGTGSAGRTTLAGSGGPGRSCTEG<SPGLSVGPVPLLVVSL |
| Parental | LFIASVFMLHIWGKYTR |
| L..ASVFM.HIW.K..R | |
| Retrocopy | LIAASVFMSHIWSKDIR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .24 RPM | 29 .57 RPM |
| SRP021940_cerebellum | 0 .21 RPM | 17 .76 RPM |
| SRP021940_embryo | 0 .03 RPM | 31 .94 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 30 .60 RPM |
| SRP021940_synovial_membrane | 0 .08 RPM | 33 .22 RPM |
| SRP021940_testis | 0 .06 RPM | 62 .86 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002457 | 3 retrocopies | |
| Equus caballus | ENSECAG00000026930 | 1 retrocopy |
retro_ecab_711 ,
|
| Echinops telfairi | ENSETEG00000005293 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004205 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000000321 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000011121 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000001097 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010661 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000053317 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000017055 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004168 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000019441 | 1 retrocopy |