RetrogeneDB ID: | retro_ecab_936 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 7:73540213..73540456(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ISCA1 | ||
Ensembl ID: | ENSECAG00000011465 | ||
Aliases: | None | ||
Description: | iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28660] |
Percent Identity: | 53.66 % |
Parental protein coverage: | 80.39 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | TPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGT |
T..A.NK.K.LL.D..EHVGVK.GV.T...NGLSY.LE..KT..D.D.EVVQD..RVFI..K........ | |
Retrocopy | TSLAANKMK*LLRDELEHVGVKFGVYTEDRNGLSYALESMKTREDPD-EVVQDEIRVFIKRKHS*YFQK* |
Parental | EMDYVEDKLSSE |
..DYV..KLS.. | |
Retrocopy | KVDYVQGKLSGD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 12 .16 RPM |
SRP021940_cerebellum | 0 .00 RPM | 23 .79 RPM |
SRP021940_embryo | 0 .00 RPM | 16 .80 RPM |
SRP021940_placental_villous | 0 .00 RPM | 19 .58 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 9 .77 RPM |
SRP021940_testis | 0 .00 RPM | 63 .82 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000046526 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000001336 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001940 | 6 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000010652 | 5 retrocopies | |
Equus caballus | ENSECAG00000011465 | 1 retrocopy |
retro_ecab_936 ,
|
Echinops telfairi | ENSETEG00000016537 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000007518 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000001288 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000003559 | 1 retrocopy | |
Mus musculus | ENSMUSG00000044792 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000019339 | 5 retrocopies | |
Pteropus vampyrus | ENSPVAG00000004588 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000018343 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000010953 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012826 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000004231 | 1 retrocopy |