RetrogeneDB ID: | retro_eeur_608 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_361660:4513..4736(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC15 | ||
| Ensembl ID: | ENSEEUG00000008785 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 15 [Source:HGNC Symbol;Acc:20325] |
| Percent Identity: | 88.0 % |
| Parental protein coverage: | 51.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | RRLARSLIAVGLGVATLAFAGRYAFQIWKPLEQVITETAKKISTPSLLSYYKGG-FEQKMSRREASLILG |
| RRLARSLIAVGLG.AT.AF.GRYAFQIWK.LEQVITETAKKISTP.LLSYYKGG.FE.KMSR.EASLILG | |
| Retrocopy | RRLARSLIAVGLGFATFAFVGRYAFQIWKTLEQVITETAKKISTPRLLSYYKGG>FE*KMSRGEASLILG |
| Parental | VSPSA |
| .SPSA | |
| Retrocopy | ESPSA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .16 RPM | 16 .76 RPM |
| SRP017611_kidney | 0 .19 RPM | 39 .95 RPM |
| SRP017611_liver | 0 .00 RPM | 26 .53 RPM |